PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016449408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 468aa    MW: 51123.1 Da    PI: 9.0659
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016449408.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-164488147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW+ eE+ ++++a k++G   W++I +++g ++t+ q++s+ qk+
   XP_016449408.1 44 RERWSDEEHRKFLEALKLHGRA-WRRIEEHVG-TKTAVQIRSHAQKF 88
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-163892IPR009057Homeodomain-like
PROSITE profilePS5129421.3513993IPR017930Myb domain
TIGRFAMsTIGR015572.2E-154291IPR006447Myb domain, plants
SMARTSM007178.9E-134391IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-94484IPR009057Homeodomain-like
PfamPF002494.6E-134487IPR001005SANT/Myb domain
CDDcd001677.75E-104689No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MTVRDQSKSD TILPSGSRTS LDVGAPADEY APKIRKPYTI SKQRERWSDE EHRKFLEALK  60
LHGRAWRRIE EHVGTKTAVQ IRSHAQKFFS KVVRESNNGD VSSVKSIEIP PPRPKRKPMH  120
PYPRKLVIPV KSGTLAPEKS KRSGSPNLCL SETENQSPTS VLSALGSDAF GTVDSSKPSE  180
SPSPVSSAVS ENCGDLVLSE QSDFNLEKRR SSPAQAYASS NPDNQACVKL ELFPEDNDFV  240
KEGSVEASST HSLKLFGKTV FVTDSCVLSS PTSGQISLAD VNNEPASRTL SQSSFPMKFS  300
PSDSECAPST VTMYHAPAAN GSPRPNKSVP CHLLSGESSY VSAAFSCTQV HNPIPMKGRA  360
FFIDKDSEEK ETQKEGSSTG SNTESVSTEL SVDKRVGIEA QSSRNREAGR ELFSVRASVP  420
SLFERRANSA KRVKGFVPYK RCLAERGISS SSTLTGEERE EKRTRLCL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1034981e-115DQ103498.1 Solanum ochranthum putative At5g37260 (CT251) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609237.10.0PREDICTED: protein REVEILLE 1-like isoform X1
RefseqXP_016449408.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM1BXP30.0M1BXP3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-54MYB_related family protein